DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gstt4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:216 Identity:54/216 - (25%)
Similarity:92/216 - (42%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...||.|.|||.:.|:..|:..:.:.::||||.|.:.|::::||...:|:|.||:..:.:|.|
Mouse     5 LYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILSESVA 69

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYI 135
            |..||..|| ......||.:|..||.||              .|:   ...:.:....:.||.:|
Mouse    70 ILFYLCRKY-SAPSHWYPPDLHMRARVD--------------EFM---AWQHTAIQVPMSKILWI 116

  Fly   136 QKCWEILEG-------------------------FLKDQPYLCGSDLTIADFCAVATVTSVNDTA 175
            :....::.|                         ||:|:.::.|..:::||..|:     |....
Mouse   117 KLIIPMITGEEVPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVAL-----VEMMQ 176

  Fly   176 PI----DEFKFPKMHAWLKRL 192
            |:    :.|...|:..|..|:
Mouse   177 PMGSNHNVFVSSKLAEWRMRV 197

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/70 (39%)
GstA 6..201 CDD:223698 54/216 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/130 (17%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 47/182 (26%)
GST_N_Theta 3..78 CDD:239348 27/72 (38%)