DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Clic3

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:194 Identity:34/194 - (17%)
Similarity:55/194 - (28%) Gaps:73/194 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PINLLKGEHLT---------------PEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQK 82
            ||.|..|:..|               |:|..|.|::........:.    .|...|::......:
Mouse    95 PILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPRYRESNTAGNDI----FHKFSAFIKNPVPTQ 155

  Fly    83 EQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWEILEGFLK 147
            :..||.:.|.....:|:.|.....|..|:...|.|                             .
Mouse   156 DNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRE-----------------------------S 191

  Fly   148 DQPYLCGSDLTIADFCAVATVTSVNDTA-------PI-----------------DEFKFPKMHA 187
            .:.:|.|...|:|| |::.....:.||.       ||                 .|||:...|:
Mouse   192 HRRFLDGDQFTLAD-CSLLPKLHIVDTVCAHFRQLPIPAELSCVRRYLDSALQKKEFKYTCPHS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 11/58 (19%)
GstA 6..201 CDD:223698 34/194 (18%)
GST_C_Delta_Epsilon 92..210 CDD:198287 20/120 (17%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 34/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.