DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gstt4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:199 Identity:56/199 - (28%)
Similarity:98/199 - (49%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...||.|.|||.:.|:..|:..:.:.::||||.|.:.|::::||...:|:|.||:..:.:|.|
  Rat     5 LYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSESVA 69

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARL---RFLYEPILYYGST------- 125
            |..||..|| ......||.:|..||.||..:...  |...::   :.|:..::....|       
  Rat    70 ILCYLCRKY-SAPSHWYPPDLHMRARVDEFMAWQ--HTAIQVPMSKILWIKLIIPMITGEEVPTE 131

  Fly   126 --DCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAW 188
              |.::|::....|.:|  |.||:|:.::.|..:::||..|:..:.....|.. :.|...|:..|
  Rat   132 RLDKTLDEVNKNIKQFE--EKFLQDKLFITGDHISLADLVALVEMMQPMGTNH-NVFISSKLAEW 193

  Fly   189 LKRL 192
            ..|:
  Rat   194 RMRV 197

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/70 (39%)
GstA 6..201 CDD:223698 56/199 (28%)
GST_C_Delta_Epsilon 92..210 CDD:198287 24/113 (21%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 27/72 (38%)