DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:280 Identity:63/280 - (22%)
Similarity:97/280 - (34%) Gaps:93/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||:.|.|..|:.|.|.....||..|.|.::|...|...|.|::||....:|..|.|:..:.|.:.
Zfish    50 LYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQ 114

  Fly    71 ICAYLVEKY-GQKEQQLYP-------------KELVQRANVDARLH---------LDS---GHLF 109
            |..|:...: |....||.|             :||:....:||..|         .||   .:..
Zfish   115 IIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPKYAT 179

  Fly   110 ARLR------------------FLYEPILYYGSTDCSI-------DKIAYIQKCWEILEGFL--- 146
            |.:|                  .|.||   |.|....:       |.:.|::|....|...|   
Zfish   180 AEIRRHLANAASELMKLDHEEPQLTEP---YLSKQKKLMAKILDHDNVNYLKKILGELAMVLDQV 241

  Fly   147 --------------KDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKF-------------PK 184
                          |.:.:|||...|:||.|..||         :...||             |.
Zfish   242 EAELEKRKLEYQGQKCELWLCGPTFTLADICLGAT---------LHRLKFLGLSRKYWEDGSRPN 297

  Fly   185 MHAWLKRLAELPYYQEVNGD 204
            :.::.:|:.:...:::|.||
Zfish   298 LQSFFERVQKRYAFRKVLGD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/70 (33%)
GstA 6..201 CDD:223698 60/275 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 34/180 (19%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 60/275 (22%)
Thioredoxin_like 48..120 CDD:294274 23/69 (33%)
GST_C_GDAP1L1 201..311 CDD:198335 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.