DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GDAP1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:285 Identity:63/285 - (22%)
Similarity:97/285 - (34%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIID 67
            |..||:.|.|..|:.|.|......|..|...::|...||..|.|::||....:|.||.||..|.:
Human    25 KLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89

  Fly    68 SHAICAYLVEKY---------GQKEQQLYP-----KELVQRANVDARLH---------LDS---G 106
            :..|..||.:.:         ..||...||     :||:....:||..|         :||   .
Human    90 ATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPA 154

  Fly   107 HLFARLRFLYEPILYYGSTDCSIDKIA----------------------------YIQKCWEILE 143
            :...|:|      ...|:|:..:.|:|                            |::|..:.||
Human   155 YATTRIR------SQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELE 213

  Fly   144 GFLK-----------------DQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKF--------- 182
            ..|.                 .||:|||...|:||.....|         :...||         
Human   214 KVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVT---------LHRLKFLGFARRNWG 269

  Fly   183 ----PKMHAWLKRLAELPYYQEVNG 203
                |.:..:.:|:.:...:.:|.|
Human   270 NGKRPNLETYYERVLKRKTFNKVLG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GstA 6..201 CDD:223698 60/278 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 31/182 (17%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 24/71 (34%)
GST_C_GDAP1 179..289 CDD:198336 18/118 (15%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.