DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and CLIC5

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:168 Identity:42/168 - (25%)
Similarity:61/168 - (36%) Gaps:63/168 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KGEHLTPE---FLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYP----KELV-QR 94
            :|.|:.||   |:|..        ||||     |...|.:        .|:|:.    |.:| ..
Human   167 EGAHMNPEIYLFVKAG--------IDGE-----SIGNCPF--------SQRLFMILWLKGVVFNV 210

  Fly    95 ANVD-----ARLH-LDSGHLFARLRFLYEPIL-YYGSTDCSIDKIAYIQKCWEILEGFLKDQPYL 152
            ..||     |.|| |..|        .:.|.| :.|.....::||          |.||::    
Human   211 TTVDLKRKPADLHNLAPG--------THPPFLTFNGDVKTDVNKI----------EEFLEE---- 253

  Fly   153 CGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLK 190
               .||...:..:|.....::||.||.|.  |..|::|
Human   254 ---TLTPEKYPKLAAKHRESNTAGIDIFS--KFSAYIK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/41 (29%)
GstA 6..201 CDD:223698 42/168 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/107 (25%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.