DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and clic5a

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:183 Identity:40/183 - (21%)
Similarity:65/183 - (35%) Gaps:66/183 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDLELRPI---NLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYP 88
            :||:.:|.   ||..|  ..|.||..|          ||.. .|.:.|..:|       |:.|.|
Zfish    50 VDLKRKPADLHNLAPG--TPPPFLTFN----------GEVR-TDVNKIEEFL-------EEMLAP 94

  Fly    89 KELVQRANVDARLHLDSGHLFARLRFLYEPILYYGST----DCSIDK--IAYIQKCWEILEGFLK 147
            .:..:.|..:...:.....:||:..      .|..:|    :.|::|  :..::|....|...|.
Zfish    95 PKYPKLAAKNKESNTAGNDIFAKFS------AYIKNTKPEANASLEKGLLKVLKKLDSFLNSPLP 153

  Fly   148 DQ--------------PYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
            |:              .||.|::||:|| |.:                .||:|
Zfish   154 DEIDAESTGEEKSSNRKYLDGNELTLAD-CNL----------------LPKLH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/52 (29%)
GstA 6..201 CDD:223698 40/183 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/115 (19%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 18/66 (27%)
O-ClC 10..244 CDD:129941 40/183 (22%)
GST_C_CLIC5 104..244 CDD:198330 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.