DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstD7

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:214 Identity:82/214 - (38%)
Similarity:125/214 - (58%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...::|.|||:.:.|||:||:|..:.||.::|:.|.|||:::|||||||||:|....|.:|.|
  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRA 70

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLR---FLYEPILYYGSTDCSIDKI 132
            |..|||||||:.:..|||.:..:||.::.||:.|.|.|:..|.   ||......:|..: ::|| 
  Fly    71 IAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE-ALDK- 133

  Fly   133 AYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPY 197
              :...:..|..||:.|.::.||.||:||...:|||::| :....|..|||.:..|||...::..
  Fly   134 --VNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTV-EWFSFDLSKFPNVERWLKNAPKVTP 195

  Fly   198 YQEVNGDGADELKSIFKAK 216
            ..|.|      |:|:.:.|
  Fly   196 GWEQN------LESLQQGK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 35/70 (50%)
GstA 6..201 CDD:223698 77/197 (39%)
GST_C_Delta_Epsilon 92..210 CDD:198287 36/120 (30%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 35/70 (50%)
GstA 6..188 CDD:223698 75/186 (40%)
GST_C_Delta_Epsilon 92..206 CDD:198287 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460338
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.