DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstD6

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:219 Identity:83/219 - (37%)
Similarity:124/219 - (56%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||..:.||.:|||::||||:|::.....:|...||.|.|.|:|:|||||||||:|....|.::.|
  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYG--STDCSIDKIA 133
            |..||||:|| |:..||||:..::|.::.||:.|.|.|:..:...:.|:|..|  .|..:::|  
  Fly    68 IVVYLVEQYG-KDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK-- 129

  Fly   134 YIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYY 198
             :...:::|..||..|.|:.|:.|::||...:||| |..:....|..|||.:..|.|..      
  Fly   130 -LNAAFDLLNNFLDGQDYVAGNQLSVADIVILATV-STTEMVDFDLKKFPNVDRWYKNA------ 186

  Fly   199 QEVNGDGADELKSIFKAK--LAEN 220
            |:|.....:.|..|..||  ||||
  Fly   187 QKVTPGWDENLARIQSAKKFLAEN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 34/70 (49%)
GstA 6..201 CDD:223698 74/196 (38%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/119 (27%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 34/70 (49%)
PLN02395 11..208 CDD:166036 75/207 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460325
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.