DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstD5

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:215 Identity:83/215 - (38%)
Similarity:123/215 - (57%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAI 71
            ||:......|.|::.|||:|:.|.::.:|.|:.:.|.|||:|||||||||||:|...:|.:|.||
  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68

  Fly    72 CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQ 136
            ..||||||| |:..|:||:..::|.|:.||:.|.|.|:......|.|:.:.|... |.:....|:
  Fly    69 AVYLVEKYG-KDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPG-SDEDFKKIE 131

  Fly   137 KCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF---KFPKMHAWLKRLAELPYY 198
            ..:|.|..||:.|.|:.|..||:||...::||:    |..|.:|   |:|.:..|.....::...
  Fly   132 SSFEYLNIFLEGQNYVAGDHLTVADIAILSTVS----TFEIFDFDLNKYPNVARWYANAKKVTPG 192

  Fly   199 QEVNGDGADELKSIFKAKLA 218
            .|.|..||.|||.:|.|:.|
  Fly   193 WEENWKGAVELKGVFDARQA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 33/69 (48%)
GstA 6..201 CDD:223698 73/196 (37%)
GST_C_Delta_Epsilon 92..210 CDD:198287 36/120 (30%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 73/185 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 33/69 (48%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460234
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.