DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gsto1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:204 Identity:52/204 - (25%)
Similarity:87/204 - (42%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPE-FLKLNPQHTIPTLIDGEATII-DS 68
            ||.....|.::...|...|.|:..:...|||..    .|: ||:.||...:|.|......:| :|
Zfish    25 LYSMRFCPFAQRTRLVLNAKGIKYDTININLKN----KPDWFLEKNPLGLVPVLETQSGQVIYES 85

  Fly    69 HAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLR-FLYE-PILYYGSTDCSI-- 129
            ...|.||.|.|  .|::|.|.:..:||  ..|:.|:   ||:::. :.|: |:......|.|.  
Zfish    86 PITCEYLDEVY--PEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFYKIPVNRTKGEDVSALE 143

  Fly   130 ----DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCA---VATVTSVNDTAPIDEFKFPKMHA 187
                ||::...   |||  ..|...:..|..:|:.|:..   ...:.::|....:|  ..|::..
Zfish   144 TELKDKLSQFN---EIL--LKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLD--GTPELKK 201

  Fly   188 WLKRLAELP 196
            |.:|:.|.|
Zfish   202 WTERMMEDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GstA 6..201 CDD:223698 52/204 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/116 (22%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 20/71 (28%)
GstA 25..210 CDD:223698 51/202 (25%)
GST_C_Omega 107..229 CDD:198293 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.