DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstD11

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:232 Identity:87/232 - (37%)
Similarity:130/232 - (56%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            ||.|.|||...|||.|::||.||.:.:|.||:.:|:|:||.|.|:|:.:||||.:||:.|....:
  Fly    22 MSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVL 86

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSID 130
            .:|.||.:|||..|| |..||||.::..||.||.||..|.|.|:.||...|.|.::.|:   .:|
  Fly    87 WESRAILSYLVAAYG-KSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGA---PLD 147

  Fly   131 --KIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKF---PKMH--AW 188
              |.|.:.:....|...|:.:.:......||||...:.||:.      ::.|:|   |..|  .|
  Fly   148 EGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQ------LEAFEFELRPYKHIRQW 206

  Fly   189 LKRLAE--LPY-YQEVNGDGADELKSIFKAKLAENRG 222
            |.|..:  .|: |:|:|.:.|:.|..:||||:.::.|
  Fly   207 LDRCKDHMAPFDYEELNANKANMLADMFKAKMNQSAG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 34/72 (47%)
GstA 6..201 CDD:223698 75/204 (37%)
GST_C_Delta_Epsilon 92..210 CDD:198287 37/127 (29%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 34/72 (47%)
GST_C_Delta_Epsilon 112..231 CDD:198287 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.