DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstD9

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:212 Identity:80/212 - (37%)
Similarity:119/212 - (56%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAI 71
            ||...|.|.|::|:||:|:||:|..:.::|..||||.|||:|:|||||||||:|....|.:|.||
  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAI 69

  Fly    72 CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYG-STDCSIDKIAYI 135
            ..||.||| .|:..||||:..|||.::.||..|...|:....:.|.|.|:.. ......|.:..|
  Fly    70 LIYLAEKY-DKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKI 133

  Fly   136 QKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF---KFPKMHAWLKRLAE-LP 196
            ...:.:....||.|.|...:.||:|||..:|||:    |..|.|:   |:|::..|.....: :|
  Fly   134 DDAFAMFNTLLKGQQYAALNKLTLADFALLATVS----TFEISEYDFGKYPEVVRWYDNAKKVIP 194

  Fly   197 YYQEVNGDGADELKSIF 213
            .::| |.:|.:..|.::
  Fly   195 GWEE-NWEGCEYYKKLY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 37/69 (54%)
GstA 6..201 CDD:223698 76/198 (38%)
GST_C_Delta_Epsilon 92..210 CDD:198287 34/122 (28%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 37/69 (54%)
GstA 4..187 CDD:223698 75/186 (40%)
GST_C_Delta_Epsilon 89..207 CDD:198287 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460299
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.