DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and MARS1

DIOPT Version :10

Sequence 1:NP_611964.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens


Alignment Length:207 Identity:41/207 - (19%)
Similarity:71/207 - (34%) Gaps:63/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IPTL-IDGEATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEP 118
            :|.| :|....:..:.|||.|.....|.::..|..:.|...|              ..|:.....
Human    48 VPVLQLDSGNYLFSTSAICRYFFLLSG
WEQDDLTNQWLEWEA--------------TELQPALSA 98

  Fly   119 ILYY-------GSTDCSIDKIAYIQKCWEILEGFLKDQ--PYLCGSDLTIADFCA-VATVTSVND 173
            .|||       |.     |.:..:::....::..|..|  |:|.|...::||... .|....:.|
Human    99 ALYYLVVQGKKGE-----DVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQD 158

  Fly   174 TAPIDEFKFPKMHAW-----------------LKR---LAELPYYQE------------VNGDGA 206
            .|.:.| :...:|:|                 ||:   ||..||.|:            .|....
Human   159 PAYLPE-ELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEE 222

  Fly   207 DELKSIFKAKLA 218
            :||.::.:.::|
Human   223 EELATLSEEEIA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_611964.1 GST_N_Delta_Epsilon 4..77 CDD:239343 7/22 (32%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/159 (18%)
MARS1NP_004981.2 GST_N_5 1..74 CDD:436537 7/25 (28%)
GST_C_MetRS_N 77..179 CDD:198340 22/121 (18%)
PLN02610 251..893 CDD:215329
'HIGH' region 273..283
'KMSKS' region 593..597
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.