DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstZ1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:228 Identity:59/228 - (25%)
Similarity:95/228 - (41%) Gaps:60/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLK---GEHLTPEFLKLNPQHTIPTL-IDGE 62
            :||.||....|..|..|.:......:|.:::|.:|||   |...|.|:.::||...:|:| |||.
  Fly    32 TKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGH 96

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDC 127
             |:.||.||..||.|.  :.:..|.|::.|:|               |::|.:.|.|       |
  Fly    97 -TLCDSVAIIHYLEET--RPQPALLPQDPVKR---------------AKIREIVELI-------C 136

  Fly   128 S----------IDKIA----------YIQKCWEILEGFLKDQ--PYLCGSDLTIADFCAVATVTS 170
            |          :|.|.          :|.:.::.||..|...  .:..|.:|::||.|.|..|.:
  Fly   137 SGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRN 201

  Fly   171 VN----DTAPIDEFKFPKMHAWLKRLAELPYYQ 199
            ..    |..|     :|.:....:.|.||..::
  Fly   202 ARRYKADLTP-----YPTIVRLNQELQELDVFK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 28/76 (37%)
GstA 6..201 CDD:223698 57/224 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/134 (20%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 27/75 (36%)
maiA 35..240 CDD:273527 57/225 (25%)
GST_C_Zeta 122..236 CDD:198300 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.