DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gstt1b

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:199 Identity:54/199 - (27%)
Similarity:95/199 - (47%) Gaps:17/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            :|....|.|.|:|.:.||...:..:.:.|:|.:|.....||.|:||....||:.||:..:.:|.|
Zfish     5 IYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVA 69

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARL---RFLYEPILYYGSTDCSIDKI 132
            |..||.:|: ......:|.:|.:||.|:.  :|...|...|:   :.::..||........:.| 
Zfish    70 IMIYLADKF-HTPDHWFPADLQKRARVNE--YLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPK- 130

  Fly   133 AYIQKCWEIL--------EGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFK-FPKMHAW 188
            ..::...|.|        :.||:|:|::.|..:::||..|:..:.. ...|.:|.|: .||:.||
Zfish   131 EKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQ-PFAAGMDVFENRPKLKAW 194

  Fly   189 LKRL 192
            ..|:
Zfish   195 KDRV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/70 (34%)
GstA 6..201 CDD:223698 54/199 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/113 (24%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 54/199 (27%)
GST_N_Theta 3..78 CDD:239348 24/72 (33%)
GST_C_Theta 91..217 CDD:198292 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.