DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstO2

DIOPT Version :10

Sequence 1:NP_611964.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:201 Identity:43/201 - (21%)
Similarity:81/201 - (40%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLK-LNPQHTIPTL----IDGEA 63
            |..:.....|.|..|.|...|..::.....::|::    .||:.| .:|...:|.|    :..:.
  Fly    23 PRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQP 83

  Fly    64 TIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHL--FARLRFLYEPILYYGSTD 126
            |:::|..|..||.::|.|  .:|:|.:.:|:|       ||...:  ||.:.....|:|.. :.:
  Fly    84 TLVESLIIAEYLDQQYPQ--TRLFPTDPLQKA-------LDKILIERFAPVVSAIYPVLTC-NPN 138

  Fly   127 CSIDKIAYIQKCWEILEGFL--KDQPYLCGSDLTIADFCA-------VATVTSVNDTAPIDEFKF 182
            ...|.|...:...::.|..|  :..||..|..:.|.|:..       .:...:......:|..:|
  Fly   139 APKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRF 203

  Fly   183 PKMHAW 188
            .|:..|
  Fly   204 EKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_611964.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/77 (23%)
GST_C_Delta_Epsilon 92..210 CDD:198287 21/108 (19%)
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 17/76 (22%)
GST_C_Omega 110..235 CDD:198293 21/108 (19%)

Return to query results.
Submit another query.