DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstO3

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:204 Identity:48/204 - (23%)
Similarity:82/204 - (40%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFL-KLNPQHTIPTL----IDGEATI 65
            ||.....|.::...|...|..:......|||.:    .||:| :::|...:|.|    ..||.::
  Fly    24 LYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSL 84

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSID 130
            |:|..|..||.:||  .|..|.||:.::||.....|     ..|:.:...:..||..|:.     
  Fly    85 IESLIIAEYLDDKY--PENPLLPKDPLKRAQDKILL-----ERFSSITSAFINILVQGTG----- 137

  Fly   131 KIAYIQKCWEILEGFLKD-----QPYLCGSDLTIAD------FCAVATV-TSVNDTAPIDEFKFP 183
                ::..|..|:.|.::     .||..|:.....|      |..::.: ..:......:|.:||
  Fly   138 ----LEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFP 198

  Fly   184 KMHAWLKRL 192
            |:..|:..|
  Fly   199 KITKWIALL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/75 (28%)
GstA 6..201 CDD:223698 48/204 (24%)
GST_C_Delta_Epsilon 92..210 CDD:198287 21/113 (19%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 20/74 (27%)
GstA 22..209 CDD:223698 48/204 (24%)
GST_C_Omega 109..230 CDD:198293 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.