DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstE8

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:215 Identity:97/215 - (45%)
Similarity:132/215 - (61%) Gaps:2/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            |||..||....|||.||..||..|:|:..|...||.|..|.|:||||:.|||||:|||.|....|
  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR-LRFLYEPILYYGSTDCSI 129
            .|||||.||||.||||.: .||||:|:|||.||.|||.:||.:|.. ||.:.:|:...|.|....
  Fly    66 WDSHAISAYLVSKYGQSD-TLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPK 129

  Fly   130 DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAE 194
            ::...:.:.::.:|.||....::.|..||||||..:.::|::.....||..|:..:.||:||:.|
  Fly   130 ERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEE 194

  Fly   195 LPYYQEVNGDGADELKSIFK 214
            ||||:|..|.||.:|.::.|
  Fly   195 LPYYEEACGKGARDLVTLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 39/72 (54%)
GstA 6..201 CDD:223698 88/195 (45%)
GST_C_Delta_Epsilon 92..210 CDD:198287 43/118 (36%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 84/192 (44%)
GST_N_Delta_Epsilon 4..77 CDD:239343 39/72 (54%)
GST_C_Delta_Epsilon 91..209 CDD:198287 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468009
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.