DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstE7

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:217 Identity:100/217 - (46%)
Similarity:132/217 - (60%) Gaps:6/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            |.|..||....|||.|||.||..|:.:..|...:|....|:.:.||||.|||||:|||.|....|
  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR-LRFLYEPILYYGSTDCSI 129
            .|||||.||||.||| |...||||:|:|||.||.|||.:||.:||. ||.:.:|:  :......|
  Fly    66 WDSHAIIAYLVSKYG-KTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPL--FAGKQTMI 127

  Fly   130 DKIAY--IQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRL 192
            .|..|  |.:.::.||.||....|:.|:.||||||..::||:|:.....:|..|:|::.||.|||
  Fly   128 PKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRL 192

  Fly   193 AELPYYQEVNGDGADELKSIFK 214
            .:||||:|.||:||...:|..:
  Fly   193 QKLPYYEEANGNGARTFESFIR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/72 (50%)
GstA 6..201 CDD:223698 92/197 (47%)
GST_C_Delta_Epsilon 92..210 CDD:198287 51/120 (43%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 88/194 (45%)
GST_N_Delta_Epsilon 4..77 CDD:239343 36/72 (50%)
GST_C_Delta_Epsilon 91..209 CDD:198287 51/119 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468014
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.