DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstE10

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:225 Identity:98/225 - (43%)
Similarity:143/225 - (63%) Gaps:3/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            |:...||....|||.||||||.:|:.||.|...:::..|:||.|:.|:.|||||:|.|.|||:.|
  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARL-RFLYEPILYYGSTDCSI 129
            .|||||..|||.||.|.: :||||:.::||.||.|||.::|.||..: :.|...:....:|:...
  Fly    66 WDSHAIIGYLVNKYAQSD-ELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPK 129

  Fly   130 DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVN-DTAPIDEFKFPKMHAWLKRLA 193
            |::|.::..:.:||.||.:.||:.|..||||||..||||:::: ...|:|..|:||:.|||.|::
  Fly   130 DRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARIS 194

  Fly   194 ELPYYQEVNGDGADELKSIFKAKLAENRGK 223
            .||:|:|.|..||..|....::||.:...|
  Fly   195 ALPFYEEDNLRGARLLADKIRSKLPKQFDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 38/72 (53%)
GstA 6..201 CDD:223698 89/196 (45%)
GST_C_Delta_Epsilon 92..210 CDD:198287 47/119 (39%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 86/193 (45%)
GST_N_Delta_Epsilon 4..77 CDD:239343 38/72 (53%)
GST_C_Delta_Epsilon 91..211 CDD:198287 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468008
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.