DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and clic4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:177 Identity:37/177 - (20%)
Similarity:67/177 - (37%) Gaps:54/177 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDLELRPI---NLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSH---AICAYLVEKYGQKEQQ 85
            :||:.:|.   ||..|.|  |.|:..|.:      :..:...|:.:   .:|.....|.|.:..:
Zfish    56 VDLKRKPADLQNLAPGTH--PPFITFNGE------VKTDVNKIEEYLEDILCPPKYSKLGARHPE 112

  Fly    86 -------LYPK--ELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCS--IDKIAYIQKCW 139
                   ::.|  ..::.:..||...|:.| |...|:.|.|.:       ||  .|:|.:.    
Zfish   113 SNTAGMDIFAKFSAFIKNSKPDANEALERG-LLKTLQKLDEYL-------CSPLPDEIDHN---- 165

  Fly   140 EILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
            .:.|.....:.:|.|.::|:|| |.:                .||:|
Zfish   166 SMEEVKASTRMFLDGEEMTLAD-CNL----------------LPKLH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/55 (22%)
GstA 6..201 CDD:223698 37/177 (21%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/97 (23%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 12/54 (22%)
O-ClC 16..250 CDD:129941 37/177 (21%)
GST_C_CLIC4 110..250 CDD:198329 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.