DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstT4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:101/252 - (40%) Gaps:67/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKP-ALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFL-KLNPQHTIPTLIDGEA 63
            ||:| ..|:..|:..|||:.:..:|..:..|..||::|||||||.||. .:|....:|.:.|...
  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65

  Fly    64 TIIDSHAICAYLV-EKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDC 127
            .:.::.||..:|. ||.  ..:..||:..:.|:.:|                   ..|.:..|:.
  Fly    66 QLSENVAIFRHLAREKL--VPEHWYPRRHLGRSRID-------------------EYLAWQQTNM 109

  Fly   128 SIDKIAYIQKCW---------------------------EILEGFLKDQPYLCGSDLTIADFCAV 165
            .:....|.|:.|                           |..:.||..:.::.|.:::.||..|:
  Fly   110 GVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAI 174

  Fly   166 ATVTSVNDTAPIDEFKFP---KMHAWLKRLAEL--PYYQEVNGDGADELKSIFKAKL 217
            .   .::....|....|.   |:..|.:.:.|.  |:|:||.|:        |:|||
  Fly   175 C---EIDQPKSIGYNAFQNRNKLARWYETVREELGPHYKEVLGE--------FEAKL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GstA 6..201 CDD:223698 49/228 (21%)
GST_C_Delta_Epsilon 92..210 CDD:198287 24/149 (16%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 24/74 (32%)
GST_C_Theta 95..220 CDD:198292 26/154 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.