DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gsto2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:225 Identity:51/225 - (22%)
Similarity:88/225 - (39%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPE-FLKLNPQHTIPTLIDGEATII-DS 68
            :|.....|.|....|..||..:..|:..|||..    .|: :...:|...:|.|.:.:..:| :|
  Rat    26 IYSMRFCPYSHRTRLVLKAKSIRHEIININLKN----KPDWYYTKHPFGQVPVLENSQCQLIYES 86

  Fly    69 HAICAYLVEKY-GQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPIL--YYGSTDCSID 130
            ...|.||.:.: |:|   |:|.:..:||.....|     .||.::..|.:..|  .....||:..
  Rat    87 VIACEYLDDVFPGRK---LFPYDPYERARQKMLL-----ELFCKVPQLSKECLVALRCGRDCTDL 143

  Fly   131 KIAYIQKCW---EILEGFLKDQPYLCGSDLTIADFC---------AVATVTSVNDTAPIDEFKFP 183
            |:|..|:..   ||||  .::..:..|..:::.|:.         .......||.|        |
  Rat   144 KVALRQELCNLEEILE--YQNTTFFGGDSISMIDYLVWPWFERLDVYGLADCVNHT--------P 198

  Fly   184 KMHAWLKRLAELPYYQEVNGDGADELKSIF 213
            .:..|:..:.:.|....::.|     |:||
  Rat   199 MLRLWISSMKQDPAVCALHID-----KNIF 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GstA 6..201 CDD:223698 47/211 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 25/131 (19%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 18/71 (25%)