DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Clic6

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:193 Identity:39/193 - (20%)
Similarity:69/193 - (35%) Gaps:67/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELR-PIN----LLKGEHLTPEFLKLNPQHTIPTLIDGE 62
            ||| ....|:|.:....:|     .|.|:: .:|    .|:.:.:.|.:.||..||.     :..
  Rat   423 KPA-DLQNLAPGTNPPFMT-----FDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHP-----ESN 476

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEP----ILYYG 123
            :...|..|..:..::...:....:|.|.|::     |...|||        :|..|    |..|.
  Rat   477 SAGNDVFAKFSAFIKNTKKDANDIYEKNLLR-----ALKKLDS--------YLNSPLPDEIDAYS 528

  Fly   124 STDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
            :.|.::.:                 :.:|.|.:||:|| |.:                .||:|
  Rat   529 TEDVTVSQ-----------------RKFLDGDELTLAD-CNL----------------LPKLH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/77 (21%)
GstA 6..201 CDD:223698 36/190 (19%)
GST_C_Delta_Epsilon 92..210 CDD:198287 19/99 (19%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 39/193 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.