DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Clic3

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:194 Identity:35/194 - (18%)
Similarity:55/194 - (28%) Gaps:73/194 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PINLLKGEHLT---------------PEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQK 82
            ||.|..|:..|               |:|..|.|::........:.    .|...|::......:
  Rat    64 PILLYDGDVKTDTLQIEEFLEETLGPPDFPGLAPRYRESNTAGNDI----FHKFSAFIKNPVPTQ 124

  Fly    83 EQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWEILEGFLK 147
            :..||.:.|.....:|..|.....|..|:...|.|                             .
  Rat   125 DDALYQQLLRALTRLDRYLGTPLDHELAQEPHLSE-----------------------------S 160

  Fly   148 DQPYLCGSDLTIADFCAVATVTSVNDTA-------PI-----------------DEFKFPKMHA 187
            .:.:|.|..||:|| |::.....:.||.       ||                 .|||:...|:
  Rat   161 RRRFLDGDQLTLAD-CSLLPKLHIVDTVCAHFRQRPIPAELSCVRRYLDSALQEKEFKYTCPHS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 11/58 (19%)
GstA 6..201 CDD:223698 35/194 (18%)
GST_C_Delta_Epsilon 92..210 CDD:198287 21/120 (18%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 35/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.