DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Eef1g

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:187 Identity:36/187 - (19%)
Similarity:79/187 - (42%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TPEFLKLNPQHTIPTLI-DGEATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSG 106
            |||||:..|...:|... |....:.:|:||..|:..:..:........::||..:     ..||.
  Rat    46 TPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVS-----FADSD 105

  Fly   107 HLFARLRFLYEPI-LYYGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTS 170
            .:.....:::..: :.:.:...:.:....:::...:|:..||.:.:|.|..:|:||...|.|:..
  Rat   106 IVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLW 170

  Fly   171 VNDTAPIDEFK--FPKMHAWLKRLAELPYYQEVNGDG--ADELKSIFKAKLAENRGK 223
            :........|:  ||..:.|.......|.::.:.|:.  .:::......|.||::.|
  Rat   171 LYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/34 (35%)
GstA 6..201 CDD:223698 31/161 (19%)
GST_C_Delta_Epsilon 92..210 CDD:198287 20/122 (16%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 12/35 (34%)
maiA 5..187 CDD:273527 29/145 (20%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 20/126 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 3/7 (43%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.