DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTT4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:241 Identity:58/241 - (24%)
Similarity:106/241 - (43%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...||.|.|||.:.:|...:....:.::||||.|.:..::.:||...:|:|.||:..:.:|.|
Human     5 LYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSESAA 69

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVD---ARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKI 132
            |..||..||....... |.:...||.||   |..|........::.:|...|......:.|.:|:
Human    70 ILYYLCRKYSAPSHWC-PPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPKITGEEVSAEKM 133

  Fly   133 AY----IQKCWEILEG-FLKDQPYLCGSDLTIADFCAV--------ATVTSVNDTAPIDEFK--- 181
            .:    ::...::.|. ||:|:.::.|:.:::||..||        |......:::.:.|::   
Human   134 EHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNSSKLAEWRMQV 198

  Fly   182 --------FPKMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAE 219
                    |.:.|..|.:||:..:         ..|.|:.|..::|
Human   199 ELNIGSGLFREAHDRLMQLADWDF---------STLDSMVKENISE 235

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/70 (36%)
GstA 6..201 CDD:223698 54/221 (24%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/144 (18%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 25/72 (35%)