DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:59/240 - (24%)
Similarity:90/240 - (37%) Gaps:70/240 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLID---GE 62
            |:...||.....|....|:|..|.:.|..|....:..|||....|.|.|||...:|||:|   .:
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHL--DSGHLFARLRFLY--------- 116
            .||.:|.||..||.:||                :.|.::.|  |....:..:::|:         
pombe    66 YTIWESDAILIYLADKY----------------DTDRKISLSFDDPEYYKLIQYLFFQASGQGVI 114

  Fly   117 ------------EPIL-----YYGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCA 164
                        ||::     |...          |::...:||..|||:.||..:..||||...
pombe   115 WGQAGWFNFFHHEPVVSAVTRYRNE----------IKRVLGVLEDILKDRDYLVANKYTIADLSF 169

  Fly   165 V------------ATVTSVNDTAPID-EFKFPKMHAWLKRLAELP 196
            :            ...:...:...:| |.:|||.:||.:||...|
pombe   170 IPWNYNLGGLFGEGKFSFKEEVPQLDFEKEFPKAYAWNQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/75 (36%)
GstA 6..201 CDD:223698 58/235 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/146 (20%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 29/95 (31%)
GstA 5..226 CDD:223698 58/236 (25%)
GST_C_Ure2p 96..219 CDD:198326 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.