DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GstT2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:231 Identity:69/231 - (29%)
Similarity:103/231 - (44%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKP-ALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEAT 64
            |||| ..||..|||.:|.:.:..|.....:|..||.|.|.|.||.|:.|:|....:|.::.|:..
  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65

  Fly    65 IIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSI 129
            :.::.||..||.:| ||.:::||||.|..||.||.  .|:..||..||.             ||:
  Fly    66 LSETIAIIRYLADK-GQFDEKLYPKTLENRARVDE--FLEWQHLNIRLA-------------CSM 114

  Fly   130 DKIAYIQKCW---------------------------EILEGFLKDQPYLCGSDLTIADFCAVAT 167
                |.:..|                           .:||....:..:|.|.:||:||....:.
  Fly   115 ----YFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSE 175

  Fly   168 VTSVN-DTAPIDEFKFPKMHAWLK--RLAELPYYQE 200
            :..:. ....:||.||||:..||:  |::..||:.|
  Fly   176 INQLRLCQYRVDEKKFPKVVKWLERVRVSANPYHDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GstA 6..201 CDD:223698 65/225 (29%)
GST_C_Delta_Epsilon 92..210 CDD:198287 33/139 (24%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/75 (33%)
GstA 7..202 CDD:223698 61/214 (29%)
GST_C_family 93..218 CDD:295467 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.