DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Clic5

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:186 Identity:41/186 - (22%)
Similarity:63/186 - (33%) Gaps:53/186 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPE-FLKLNPQHTIPTLIDGEATII 66
            |||..: .|:|.:....||... .:..::..|.....|.|||| :.||..:|.     :.....|
Mouse   293 KPADLH-NLAPGTHPPFLTFNG-DVKTDVNKIEEFLEETLTPEKYPKLAAKHR-----ESNTAGI 350

  Fly    67 DSHA-ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSID 130
            |..: ..||:.....|....|      :|....|...||.        :|..|:.....|:...|
Mouse   351 DIFSKFSAYIKNTKQQNNAAL------ERGLTKALRKLDD--------YLNSPLPEEIDTNTHGD 401

  Fly   131 KIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
            :....:|             :|.|.:||:|| |.:                .||:|
Mouse   402 EKGSQRK-------------FLDGDELTLAD-CNL----------------LPKLH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/74 (26%)
GstA 6..201 CDD:223698 38/183 (21%)
GST_C_Delta_Epsilon 92..210 CDD:198287 19/95 (20%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 41/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.