Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 73/201 - (36%) | Gaps: | 39/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTL-IDGEATIIDSH 69
Fly 70 AICAYLVEKYGQKEQQLYPKELVQRAN-----VDARLHL------DSGHLFARLRFLYEPILYYG 123
Fly 124 STDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCA-VATVTSVNDTAPIDEFKFPKMHA 187
Fly 188 WLKRLA 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 21/71 (30%) |
GstA | 6..201 | CDD:223698 | 46/201 (23%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 22/114 (19%) | ||
Mars1 | NP_001165053.1 | Thioredoxin_like | 1..68 | CDD:294274 | 20/68 (29%) |
GstA | <47..189 | CDD:223698 | 32/155 (21%) | ||
GST_C_MetRS_N | 77..179 | CDD:198340 | 24/123 (20%) | ||
PRK12268 | 266..821 | CDD:237029 | |||
MetRS_core | 267..635 | CDD:173907 | |||
'HIGH' region | 275..285 | ||||
'KMSKS' region | 595..599 | ||||
Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
MetRS_RNA | 855..899 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |