DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-21

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:210 Identity:47/210 - (22%)
Similarity:76/210 - (36%) Gaps:44/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFL---KLNPQHTIPTLIDGEATIIDSHAIC 72
            |:.|:| :|.....:..:....|:::..|..:.||..   |..|....|.|...:..|..|.||.
 Worm    26 LAEPAR-MLFHLGGVPFEDSRIPVDMKTGLIMNPELADVKKKAPFGKYPVLKIDDIEIAQSAAIN 89

  Fly    73 AYLVEKYGQKEQQLYPKELVQRANVDARLHLDS---------GHLFARLRFLYEPILYYGSTDCS 128
            .||..::|     ...|..::.|..|:  ::|.         ..::|.|:         |..:..
 Worm    90 RYLARQFG-----FAGKNPIEEAQADS--YIDQCQEYNTSFRACMYATLQ---------GKPEEE 138

  Fly   129 IDKI---AYI---QKCWEILEGFL--KDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKM 185
            :.||   .||   .|.:||....|  ....:|.|..||.||......:.|::....:..     .
 Worm   139 VQKIREEVYIPAQNKFYEIFSDILNRNKSGFLVGDSLTWADLVIADHLYSLDTMGMLTH-----E 198

  Fly   186 HAWLKRLAELPYYQE 200
            .||  |...|..:||
 Worm   199 DAW--RCETLKKFQE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/68 (26%)
GstA 6..201 CDD:223698 47/210 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/126 (21%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 18/68 (26%)
PTZ00057 18..231 CDD:173353 47/210 (22%)
GST_C_Sigma_like 104..213 CDD:198301 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.