DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-43

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:215 Identity:61/215 - (28%)
Similarity:88/215 - (40%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHL-TPEFLKLNPQHTIPTLIDGEAT 64
            |:||.||....|..:..|.:......:|.|.|||:|...|.. ..||:|.||...:|||:....:
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDA-RLHLDSG---------HLFARLRFLYEPI 119
            :.:|.||..||.|.|  .:....||||.:|:...| .||:.:.         |     :.|.|..
 Worm    66 LTESLAIIEYLDEAY--PDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIH-----KMLNEKE 123

  Fly   120 LYYGSTDCSIDKIAYIQKCWEILEGFLKDQ--PYLCGSDLTIA----------------DFCAVA 166
            ..||...|:    .::.|.:..||..||..  .|..|..||||                |.....
 Worm   124 PGYGDFWCN----HFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYP 184

  Fly   167 TVTSVNDTAPIDEFKFPKMH 186
            |:|.:|:.. .::|:|...|
 Worm   185 TITRINEIL-AEDFRFKLAH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GstA 6..201 CDD:223698 58/210 (28%)
GST_C_Delta_Epsilon 92..210 CDD:198287 28/123 (23%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 24/72 (33%)
maiA 5..211 CDD:273527 58/211 (27%)
GST_C_Zeta 90..207 CDD:198300 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.