DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:209 Identity:58/209 - (27%)
Similarity:91/209 - (43%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATII 66
            :||.||.:..|..|..|........:|.|.:|:||| .:....||...||...:|.|.....|:.
 Worm     3 AKPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLL-NKQKEQEFHGNNPAEKVPILKINGLTLT 66

  Fly    67 DSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILY---------Y 122
            :|.||..||.|.|  .:..|.|||    ..:.||....:.|:.:.::.|....:|         |
 Worm    67 ESMAIIEYLDEIY--PDPPLLPKE----PELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGY 125

  Fly   123 GSTDCSIDKIAYIQKCWEILEGFLK--DQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKM 185
            |...|.    .:|.|.::.||..|:  ...:..|:.::|||.|..:.|.:..:...:|...:|.:
 Worm   126 GDFWCQ----HFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKYHVDMTPYPII 186

  Fly   186 HAWLKRLAELPYYQ 199
            .....:|||||.:|
 Worm   187 TRISNKLAELPEFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GstA 6..201 CDD:223698 56/205 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/119 (23%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 23/71 (32%)
maiA 18..211 CDD:273527 52/194 (27%)
GST_C_Zeta 89..207 CDD:198300 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.