DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-14

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:199 Identity:49/199 - (24%)
Similarity:84/199 - (42%) Gaps:28/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSRAVLLTAKAI----GLDLELRPINLLKGEHLTPEFLK-LNPQHTIPTLIDGEATIIDSHAICA 73
            |.|.:..:|:.:    |:..|...:|.|..   |.|.:| ..|...:|.|...:..|..|.||..
 Worm    10 PVRGLAESARLLFHLAGVPFEDERVNFLDD---TWEKMKGKTPMGQLPVLTVDDFEIPQSAAINR 71

  Fly    74 YLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPIL--YYGSTDCSIDKI-AYI 135
            ||..|:|...:.  |:|   .|.|||.:. .....||..|.|   ::  ..|.:...::|: |.:
 Worm    72 YLARKFGFAGKT--PEE---EAWVDAVVD-QFKDFFAEFRKL---VIAKRVGKSAEELEKLTAEV 127

  Fly   136 QK-----CWEILEGFLKDQP--YLCGSDLTIADFCAVATVTSVNDTAPID-EFKFPKMHAWLKRL 192
            .|     .:::|.|.|:...  ||.|..:|.||......:.::.....:: ..:.||:.|.|:::
 Worm   128 IKPAMDVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQPKLAAHLEKV 192

  Fly   193 AELP 196
            ...|
 Worm   193 YSHP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/67 (28%)
GstA 6..201 CDD:223698 49/199 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/116 (22%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 19/67 (28%)
PTZ00057 6..205 CDD:173353 49/199 (25%)
GST_C_Sigma_like 85..192 CDD:198301 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.