Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496861.1 | Gene: | gst-14 / 185409 | WormBaseID: | WBGene00001762 | Length: | 210 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 28/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PSRAVLLTAKAI----GLDLELRPINLLKGEHLTPEFLK-LNPQHTIPTLIDGEATIIDSHAICA 73
Fly 74 YLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPIL--YYGSTDCSIDKI-AYI 135
Fly 136 QK-----CWEILEGFLKDQP--YLCGSDLTIADFCAVATVTSVNDTAPID-EFKFPKMHAWLKRL 192
Fly 193 AELP 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/67 (28%) |
GstA | 6..201 | CDD:223698 | 49/199 (25%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 26/116 (22%) | ||
gst-14 | NP_496861.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 19/67 (28%) |
PTZ00057 | 6..205 | CDD:173353 | 49/199 (25%) | ||
GST_C_Sigma_like | 85..192 | CDD:198301 | 26/113 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |