DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-24

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:230 Identity:56/230 - (24%)
Similarity:94/230 - (40%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATL---SPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQ---HTIPTL- 58
            |.:..|||..|   :.|:|.:...|     .:|...:.:..|   |||:..|.|:   ..:|.| 
 Worm     1 MPQYKLYYFNLRGWAEPARQLFKLA-----HVEFEDVRIENG---TPEWGALKPKTPFGQLPFLS 57

  Fly    59 IDGEATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPI--LY 121
            :|| ..|..|.||..||.:|:|..     .|...:.|.|||        :..:.:....|:  |.
 Worm    58 VDG-FEIPQSAAILRYLAKKFGYA-----GKTSEEEAWVDA--------IVDQFKDFVTPLRQLI 108

  Fly   122 YGSTDCSIDKIAYIQK---------CWEILEGFLKDQP--YLCGSDLTIADFCAVATVTSVNDTA 175
            ......:.::|..|||         .::||.|.|:...  :|.|..:|.||......:|::....
 Worm   109 MAQRSGNAEEIERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLG 173

  Fly   176 PIDEF-KFPKMHAWLKRLAELPYYQEVNGDGADEL 209
            ..|:. :..|:.|..:::.|:|..:|.|....|.:
 Worm   174 VFDKHGEEQKLAALREKVNEIPEIKEHNSSRPDSV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/79 (30%)
GstA 6..201 CDD:223698 52/215 (24%)
GST_C_Delta_Epsilon 92..210 CDD:198287 28/132 (21%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 24/79 (30%)
PTZ00057 6..208 CDD:173353 55/223 (25%)
GST_C_Sigma_like 85..191 CDD:198301 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.