DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-42

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:214 Identity:58/214 - (27%)
Similarity:95/214 - (44%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPT-LIDGEATII 66
            ||.||....|..|..|.:......:|.|.:.::|| .|....:..::||...:|| ::||: .|.
 Worm     5 KPVLYSYWRSSCSWRVRIALALKNVDYEYKTVDLL-SEEAKSKLKEINPAAKVPTFVVDGQ-VIT 67

  Fly    67 DSHAICAYLVEKYGQKEQQLYPKELVQRANVDA-RLHLDSG----HLFARLRFLYEPILYYGSTD 126
            :|.||..||.|.:  .:..|.||:.::||:..| .|.:.||    |....|:.|.:....:|...
 Worm    68 ESLAIIEYLEETH--PDVPLLPKDPIKRAHARAISLLVASGIQPLHNLKVLQLLNKKEAGFGGQF 130

  Fly   127 CSIDKIAYIQKCWEILEGFLKDQ--PYLCGSDLTIADFCAVATVTSVN----DTAPIDEFKFPKM 185
            ..    .::.:....||..||..  .|..|.|:||||......:.|.|    |.:|     :|.:
 Worm   131 AK----QFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSP-----YPTV 186

  Fly   186 HAWLKRLAELPYYQEVNGD 204
            :...:.||::|.:...:.|
 Worm   187 NRINETLADIPAFIAAHPD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/73 (32%)
GstA 6..201 CDD:223698 55/206 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 30/124 (24%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 22/72 (31%)
maiA 7..211 CDD:273527 56/212 (26%)
GST_C_Zeta 90..207 CDD:198300 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.