DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and gst-27

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:205 Identity:42/205 - (20%)
Similarity:73/205 - (35%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTL-IDGEATIIDSHAICAYLVE 77
            |:|.:...|     |:......:..|:..........|....|.| :|| ..|..|.||..||.:
 Worm    17 PARILFHLA-----DVPFEDFRMTIGDGTWENLKAKTPFGQAPVLSVDG-FEIPQSAAINRYLAK 75

  Fly    78 KYG----QKEQQLYPKELVQ-------------RANVDARLHLDSGHLFARLRFLYEPILYYGST 125
            ::|    ..|:|.:...:|.             :|:...:...:.|.:.              .:
 Worm    76 QFGYAGKTPEEQAWTDAIVDQYKDFMVSIKEVGKASAAGKSAEEVGKII--------------QS 126

  Fly   126 DCSIDKIAYIQKCWEILE----GFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
            |....:.|:.....:|||    ||      |.|..|||||...|..:|:::........:.||:.
 Worm   127 DLVPARDAFFVIINKILEKSKSGF------LVGDGLTIADIVIVECITTLDKHQLFTASEQPKLV 185

  Fly   187 AWLKRLAELP 196
            |..:::..:|
 Worm   186 ALREKVYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/63 (25%)
GstA 6..201 CDD:223698 42/205 (20%)
GST_C_Delta_Epsilon 92..210 CDD:198287 23/122 (19%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 16/63 (25%)
PTZ00057 6..208 CDD:173353 42/205 (20%)
GST_C_Sigma_like 85..191 CDD:198301 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.