Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497116.1 | Gene: | gst-27 / 175166 | WormBaseID: | WBGene00001775 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 42/205 - (20%) |
---|---|---|---|
Similarity: | 73/205 - (35%) | Gaps: | 48/205 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTL-IDGEATIIDSHAICAYLVE 77
Fly 78 KYG----QKEQQLYPKELVQ-------------RANVDARLHLDSGHLFARLRFLYEPILYYGST 125
Fly 126 DCSIDKIAYIQKCWEILE----GFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMH 186
Fly 187 AWLKRLAELP 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 16/63 (25%) |
GstA | 6..201 | CDD:223698 | 42/205 (20%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 23/122 (19%) | ||
gst-27 | NP_497116.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 16/63 (25%) |
PTZ00057 | 6..208 | CDD:173353 | 42/205 (20%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 24/125 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |