DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gstz1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:216 Identity:64/216 - (29%)
Similarity:97/216 - (44%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLK--GEHLTPEFLKLNPQHTIPTL-IDGEAT 64
            ||.||....|..|..|.:.....|:|.|:.||||:|  |:..|.||..|||...:|.| ||| .|
Mouse     5 KPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDG-IT 68

  Fly    65 IIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLD---SGHLFARLRFLYEPILYYGSTD 126
            |:.|.||..||.|.  :...:|.|::..:||.|  |:..|   ||         .:|:     .:
Mouse    69 IVQSLAIMEYLEET--RPIPRLLPQDPQKRAIV--RMISDLIASG---------IQPL-----QN 115

  Fly   127 CSI-------DKIAYIQKC----WEILEGFLKDQ--PYLCGSDLTIADFCAVATVTSVNDTAPID 178
            .|:       :::.:.||.    :..||..|:..  .|..|.::::||.|.|..|.:. :...:|
Mouse   116 LSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANA-ERFKVD 179

  Fly   179 EFKFPKMHAWLKRLAELPYYQ 199
            ...:|.:....|.|..|..:|
Mouse   180 LSPYPTISHINKELLALEVFQ 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 33/75 (44%)
GstA 6..201 CDD:223698 62/213 (29%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/124 (22%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 32/74 (43%)
maiA 7..211 CDD:273527 62/214 (29%)
Glutathione binding 14..19 2/4 (50%)