DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gstt2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:222 Identity:61/222 - (27%)
Similarity:108/222 - (48%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGE-------A 63
            ||...||.|||||.:.||..|:..:.|.:::|||:|::.:|.::|..:.:|.|.||.       :
Mouse     5 LYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPS 69

  Fly    64 TIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARL--HLDSGHLFARLRFLYEPILY----- 121
            ::|.|.||..||..|| |.....||.:|..||.|...|  |.|:      :|..:..:|:     
Mouse    70 SMIPSTAILIYLSSKY-QVADHWYPADLQARAQVHEYLGWHADN------IRGTFGVLLWTKVLG 127

  Fly   122 --------YGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPI- 177
                    ....:.:.|::..:.:  ::.:.||:|:.:|.|..:|:||..::..:..     |: 
Mouse   128 PLIGVQVPQEKVERNRDRMVLVLQ--QLEDKFLRDRAFLVGQQVTLADLMSLEELMQ-----PVA 185

  Fly   178 ---DEFK-FPKMHAWLKRL-----AEL 195
               :.|: .|::.||.:|:     |||
Mouse   186 LGYNLFEGRPQLTAWRERVEAFLGAEL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 29/77 (38%)
GstA 6..201 CDD:223698 61/222 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/129 (20%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 29/79 (37%)
GST_C_Theta 98..223 CDD:198292 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.