DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gstt1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:198 Identity:61/198 - (30%)
Similarity:102/198 - (51%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...||.|.||:.:.||...:..::..:.|.|||||:..|.::||...:|.::||..|:.:|.|
Mouse     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVA 69

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARL---HLDSGHLFARLRFLYEPIL---YYGS---TD 126
            |..||..|| :.....||::|..||.||..|   |  :|...:.||.|:..::   :.|.   .:
Mouse    70 ILLYLAHKY-KVPDHWYPQDLQARARVDEYLAWQH--TGLRRSCLRALWHKVMFPVFLGEQIPPE 131

  Fly   127 CSIDKIAYIQKCWEILEG-FLKDQPYLCGSDLTIADFCAVATVT-SVNDTAPIDEFKFPKMHAWL 189
            .....:|.:....::||. ||:|:.:|.|..:::||..|:..:. .|....|:.| ..|::.||.
Mouse   132 TLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFE-GHPRLAAWY 195

  Fly   190 KRL 192
            :|:
Mouse   196 QRV 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/70 (39%)
GstA 6..201 CDD:223698 61/198 (31%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/112 (26%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 61/198 (31%)
GST_N_Theta 3..78 CDD:239348 27/72 (38%)