| Sequence 1: | NP_611964.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_319968.4 | Gene: | LOC1280155 / 1280155 | VectorBaseID: | AGAMI1_001249 | Length: | 454 | Species: | Anopheles gambiae |
| Alignment Length: | 37 | Identity: | 10/37 - (27%) |
|---|---|---|---|
| Similarity: | 16/37 - (43%) | Gaps: | 8/37 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 ELTKSDEIGRHFVATKTIEKDTILFSENPLVIGPKWN 83 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE12 | NP_611964.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 8/29 (28%) |
| GST_C_Delta_Epsilon | 92..210 | CDD:198287 | |||
| LOC1280155 | XP_319968.4 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||