DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and LOC1280155

DIOPT Version :10

Sequence 1:NP_611964.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_319968.4 Gene:LOC1280155 / 1280155 VectorBaseID:AGAMI1_001249 Length:454 Species:Anopheles gambiae


Alignment Length:37 Identity:10/37 - (27%)
Similarity:16/37 - (43%) Gaps:8/37 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELTKSDEIGRHFVATKTIEKDTILFSENPLVIGPKWN 83
            |:.|.:|        :.||||..:..|...:.|.:.|
Mosquito    50 EIKKREE--------ERIEKDIAIILEENTIDGGEQN 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_611964.1 GST_N_Delta_Epsilon 4..77 CDD:239343 8/29 (28%)
GST_C_Delta_Epsilon 92..210 CDD:198287
LOC1280155XP_319968.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.