DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and AIMP3

DIOPT Version :10

Sequence 1:NP_611964.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:55 Identity:13/55 - (23%)
Similarity:27/55 - (49%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LEGFLKDQPYLCGSDLTIADFCAVATV-TSVNDTAPIDEFKFPKMHAWLKRLAEL 195
            |..:|:.:.||....|::||.....|: .::.:..|:::..|..:..|...|.:|
Mosquito   100 LNFYLQSRSYLVNDTLSVADVVVFHTIHETMANLQPLEKENFLNVSRWFHHLQQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_611964.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 92..210 CDD:198287 13/55 (24%)
AIMP3XP_061501516.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.