DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and CLIC2

DIOPT Version :10

Sequence 1:NP_611964.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:52 Identity:13/52 - (25%)
Similarity:23/52 - (44%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YLCGSDLTIADFCAVATVTSVNDTA--PIDEFKFPKMHAWLKRLAELPYYQE 200
            :|.|..||:|| |::....::...|  ...:|..|...:.:.|.....|.:|
Human   173 FLDGDQLTLAD-CSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYARE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_611964.1 GST_N_Delta_Epsilon 4..77 CDD:239343
GST_C_Delta_Epsilon 92..210 CDD:198287 13/52 (25%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96
N-terminal 1..94
O-ClC 12..245 CDD:129941 13/52 (25%)
G-site. /evidence=ECO:0000305|PubMed:25581026 30..33
Joint loop 95..106
C-terminal 107..247 13/52 (25%)
Foot loop 151..171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.