DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and Gsto1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:92 Identity:28/92 - (30%)
Similarity:45/92 - (48%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPE-FLKLNPQHTIPTLIDGEATIIDSH 69
            :|.....|.::..|:..||.|:..|:..|||..    .|| |.:.||...:|.|.:.:..:|...
  Rat    26 VYSMRFCPFAQRTLMVLKAKGIRHEIININLKN----KPEWFFEKNPFGLVPVLENTQGHLITES 86

  Fly    70 AI-CAYLVEKYGQKEQQLYPKELVQRA 95
            .| |.||.|.|  .|::|:|.:..::|
  Rat    87 VITCEYLDEAY--PEKKLFPDDPYEKA 111

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GstA 6..201 CDD:223698 28/92 (30%)
GST_C_Delta_Epsilon 92..210 CDD:198287 1/4 (25%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/71 (30%)
GstA 26..214 CDD:223698 28/92 (30%)