| Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001298275.1 | Gene: | vars1 / 114427 | ZFINID: | ZDB-GENE-010601-1 | Length: | 1271 | Species: | Danio rerio |
| Alignment Length: | 216 | Identity: | 43/216 - (19%) |
|---|---|---|---|
| Similarity: | 82/216 - (37%) | Gaps: | 70/216 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 AKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQL 86
Fly 87 YPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGS--TDCSID--KIA----YIQKCWEIL- 142
Fly 143 -------EGFLK-DQPYLCGSDLTIADFCAVATVTSVNDTAPID----EFKFPKM-----HAWLK 190
Fly 191 RLAEL------PYYQEVNGDG 205 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 8/54 (15%) |
| GstA | 6..201 | CDD:223698 | 42/210 (20%) | ||
| GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 29/146 (20%) | ||
| vars1 | NP_001298275.1 | GstA | <45..192 | CDD:223698 | |
| GST_C_ValRS_N | 80..202 | CDD:198327 | |||
| PTZ00419 | 291..1270 | CDD:240411 | 43/216 (20%) | ||
| ValRS_core | 340..941 | CDD:185677 | 22/108 (20%) | ||
| tRNA-synt_1_2 | 518..643 | CDD:290334 | |||
| Anticodon_Ia_Val | 941..1081 | CDD:153416 | 21/107 (20%) | ||
| Val_tRNA-synt_C | 1203..1266 | CDD:287436 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||