Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303556.1 | Gene: | LOC100333907 / 100333907 | -ID: | - | Length: | 249 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 45/204 - (22%) |
---|---|---|---|
Similarity: | 75/204 - (36%) | Gaps: | 71/204 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 LDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPKEL 91
Fly 92 VQR-----ANVDA-----------RLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWE 140
Fly 141 ILEGFLKD-----QPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLA------E 194
Fly 195 LPYYQEVNG 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 12/49 (24%) |
GstA | 6..201 | CDD:223698 | 43/200 (22%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 28/139 (20%) | ||
LOC100333907 | XP_009303556.1 | O-ClC | 14..249 | CDD:129941 | 45/204 (22%) |
GST_N_CLIC | 14..101 | CDD:239359 | 14/59 (24%) | ||
GST_C_family | 108..248 | CDD:295467 | 28/137 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589520 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |