DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and LOC100333907

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:204 Identity:45/204 - (22%)
Similarity:75/204 - (36%) Gaps:71/204 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPKEL 91
            :||:.:|.:|   :.|.|   ..||    |.:......::|.:.|..:|.|:.|..:   |||..
Zfish    54 VDLKRKPADL---QDLAP---GTNP----PFMTFNGEVLVDVNKIEEFLEERLGPPQ---YPKLA 105

  Fly    92 VQR-----ANVDA-----------RLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWE 140
            .:.     |.:|.           |...:.|...|.|:.|..           :|:........|
Zfish   106 TKHPESNTAGIDVFAKFSAYIKNPRKEANEGLEKALLKSLKR-----------LDEYLQTPLPEE 159

  Fly   141 ILEGFLKD-----QPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLA------E 194
            |....|:|     :.:|.|.:||:|| |.:                .||:|. :|.:|      |
Zfish   160 IDADSLEDPGASTRSFLDGDELTLAD-CNL----------------LPKLHI-IKIVARKYRGLE 206

  Fly   195 LPYYQEVNG 203
            :|  .|::|
Zfish   207 IP--AEMSG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/49 (24%)
GstA 6..201 CDD:223698 43/200 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 28/139 (20%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 45/204 (22%)
GST_N_CLIC 14..101 CDD:239359 14/59 (24%)
GST_C_family 108..248 CDD:295467 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.