DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and eef1e1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:149 Identity:29/149 - (19%)
Similarity:57/149 - (38%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IPTLIDGEA-TIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEP 118
            ||.|...:. :::....|.::||::  .|:::|......::|.|.              ::|...
 Frog    30 IPVLQTNKGPSLVGLSTIASHLVKE--AKKEELLGSTAEEKAIVQ--------------QWLEYR 78

  Fly   119 ILYYGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFC------AVATVTSVNDTAPI 177
            |.|........|    |:.....|..:|||:.::.|:.:|:||..      .|.|..||.     
 Frog    79 ISYIDRASSKED----IRNVLNDLNHYLKDKVFVAGNTVTLADILIYYGLHPVITGLSVQ----- 134

  Fly   178 DEFKFPKMHAWLKRLAELP 196
            ::..:..:..|...:...|
 Frog   135 EKETYINVSRWFSHIQNYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 5/22 (23%)
GstA 6..201 CDD:223698 29/149 (19%)
GST_C_Delta_Epsilon 92..210 CDD:198287 21/111 (19%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.