DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and NEURL3

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001272414.1 Gene:NEURL3 / 93082 HGNCID:25162 Length:262 Species:Homo sapiens


Alignment Length:267 Identity:62/267 - (23%)
Similarity:98/267 - (36%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGSLECAPTLSSRKRQLSRFH-PYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEI 109
            :|:..|....:...|:..||| ...|:.::|.....:|:||.:|.|.:.||:||:..|:...:.:
Human     1 MGAQLCFEANAKAPREALRFHAEAKGAQVRLDTRGCIAHRRTTFHDGIVFSQRPVRLGERVALRV 65

  Fly   110 EKIERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIE 174
            .:.|.||.|.:|:|.|.|.|..:...|  ||.|..|||.....:|                    
Human    66 LREESGWCGGLRVGFTRLDPACVSVPS--LPPFLCPDLEEQSPTW-------------------- 108

  Fly   175 PETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKG 239
                                 ..:||:       |.....|::      |..:        |.:|
Human   109 ---------------------AAVLPE-------GCALTGDLV------RFWV--------DRRG 131

  Fly   240 ELHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLEGILSLQSACRNVILESFAEDA 304
            .|...:|...|..:...:|:. |||:.|:|||||||.|.::                     :..
Human   132 CLFAKVNAGCRLLLREGVPVG-APLWAVMDVYGTTKAIELL---------------------DPT 174

  Fly   305 ISELPLP 311
            .|.||.|
Human   175 ASRLPTP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 55/216 (25%)
SOCS_SOCS_like 283..321 CDD:239687 4/29 (14%)
NEURL3NP_001272414.1 NEUZ 16..138 CDD:128856 40/185 (22%)
SPRY 19..171 CDD:295394 55/216 (25%)
Neuralized 20..85 CDD:284568 22/64 (34%)
zf-C3HC4_3 200..247 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.